SCOPe 2.08: Domain d3eg5c_: 3eg5 C:

Lineage for d3eg5c_ (3eg5 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159559] (2 PDB entries)

8. Domain d3eg5c_: 3eg5 C: [158147]
   Other proteins in same PDB: d3eg5b_, d3eg5d_
   automated match to d1ajea_
   complexed with gnp, mg

Details for d3eg5c_

PDB Entry: 3eg5, 2.7 Å

PDB Description: crystal structure of mdia1-tsh gbd-fh3 in complex with cdc42-gmppnp

PDB Compounds: (C:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d3eg5c_:

Sequence; same for both SEQRES and ATOM records:

>d3eg5c_ c.37.1.8 (C:) CDC42 {Mouse (Mus musculus) [TaxId: 10090]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale

Timeline for d3eg5c_:

• d3eg5c_ first appeared in SCOP 1.75, called d3eg5c1
  
• d3eg5c_ appears in SCOPe 2.07