Lineage for d3eg5b_ (3eg5 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006858Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 protein domains)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
  6. 2006871Protein automated matches [190973] (1 species)
    not a true protein
  7. 2006872Species Mouse (Mus musculus) [TaxId:10090] [188630] (1 PDB entry)
  8. 2006873Domain d3eg5b_: 3eg5 B: [161659]
    Other proteins in same PDB: d3eg5a_, d3eg5c_
    automated match to d1z2cb1
    complexed with gnp, mg

Details for d3eg5b_

PDB Entry: 3eg5 (more details), 2.7 Å

PDB Description: crystal structure of mdia1-tsh gbd-fh3 in complex with cdc42-gmppnp
PDB Compounds: (B:) Protein diaphanous homolog 1

SCOPe Domain Sequences for d3eg5b_:

Sequence, based on SEQRES records: (download)

>d3eg5b_ a.118.1.23 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmnqkessrsammyiqe
lrsglrdmhllscleslrvsltshpvswvqtfgaeglaslldilkrlhdekeetsgnyds
rnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcilpq
pedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeldfr
vhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfg
evfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh

Sequence, based on observed residues (ATOM records): (download)

>d3eg5b_ a.118.1.23 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtssrsammyiqelrsglrdmh
llscleslrvsltshpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmnn
kfgiktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamtera
emdeverfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvl
qelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdskae
phflsilqhlllvrndyearpqyyklieecvsqivlh

SCOPe Domain Coordinates for d3eg5b_:

Click to download the PDB-style file with coordinates for d3eg5b_.
(The format of our PDB-style files is described here.)

Timeline for d3eg5b_: