PDB entry 3eg5

View 3eg5 on RCSB PDB site
Description: Crystal structure of MDIA1-TSH GBD-FH3 in complex with CDC42-GMPPNP
Class: signaling protein
Keywords: PROTEIN-PROTEIN COMPLEX, RHO PROTEINS, DIAPHANOUS, FORMINS, ARMADILLO REPEAT, G-PROTEIN, GTPASE, Alternative splicing, Cell membrane, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, Actin-binding, Cell projection, Coiled coil, Cytoplasm, Cytoskeleton, Phosphoprotein, Ubl conjugation, SIGNALING PROTEIN
Deposited on 2008-09-10, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 42 homolog
    Species: Mus musculus [TaxId:10090]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eg5a_
  • Chain 'B':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08808
      • engineered (95-97)
    Domains in SCOPe 2.07: d3eg5b_
  • Chain 'C':
    Compound: Cell division control protein 42 homolog
    Species: Mus musculus [TaxId:10090]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eg5c_
  • Chain 'D':
    Compound: Protein diaphanous homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08808
      • engineered (95-97)
    Domains in SCOPe 2.07: d3eg5d_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eg5A (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eg5B (B:)
    dptaqslqdisdeqvlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmn
    qkessrsammyiqelrsglrdmhllscleslrvsltshpvswvqtfgaeglaslldilkr
    lhdekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmi
    daakllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclql
    inalitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlk
    grlddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieec
    vsqivlhkngtdpdfkcrhlqid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eg5B (B:)
    vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtssrsammyiqelrsglrdmh
    llscleslrvsltshpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmnn
    kfgiktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamtera
    emdeverfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvl
    qelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdskae
    phflsilqhlllvrndyearpqyyklieecvsqivlh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eg5C (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3eg5D (D:)
    dptaqslqdisdeqvlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmn
    qkessrsammyiqelrsglrdmhllscleslrvsltshpvswvqtfgaeglaslldilkr
    lhdekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmi
    daakllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclql
    inalitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlk
    grlddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieec
    vsqivlhkngtdpdfkcrhlqid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eg5D (D:)
    vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtssrsammyiqelrsglrdmh
    llscleslrvsltshpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmnn
    kfgiktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamtera
    emdeverfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvl
    qelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdskae
    phflsilqhlllvrndyearpqyyklieecvsqivlh