Lineage for d3dll21 (3dll 2:1-46)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2597858Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2597859Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 2597860Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 2597861Protein Ribosomal protein L34p [144323] (3 species)
  7. 2597862Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 2597864Domain d3dll21: 3dll 2:1-46 [157776]
    Other proteins in same PDB: d3dll11, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR 2:1-46
    complexed with mg, zld, zn

Details for d3dll21

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d3dll21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dll21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d3dll21:

Click to download the PDB-style file with coordinates for d3dll21.
(The format of our PDB-style files is described here.)

Timeline for d3dll21: