SCOPe 2.08: Domain d3dlll1: 3dll L:8-111

Lineage for d3dlll1 (3dll L:8-111)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
   Uniprot Q9RSL2 8-111

8. Domain d3dlll1: 3dll L:8-111 [157789]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR L:8-111
   complexed with mg, zld, zn
   has additional insertions and/or extensions that are not grouped together

Details for d3dlll1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (L:) 50S ribosomal protein L18

SCOPe Domain Sequences for d3dlll1:

Sequence; same for both SEQRES and ATOM records:

>d3dlll1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

Timeline for d3dlll1:

• d3dlll1 first appeared in SCOP 1.75
  
• d3dlll1 appears in SCOPe 2.07