Lineage for d3dllg1 (3dll G:30-171)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855226Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2855227Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2855228Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2855229Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2855230Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries)
    Uniprot Q9RXY1 30-171
  8. 2855233Domain d3dllg1: 3dll G:30-171 [157784]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR G:30-171
    complexed with mg, zld, zn

Details for d3dllg1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (G:) 50S ribosomal protein L13

SCOPe Domain Sequences for d3dllg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]}
ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva
ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk
vyagethphsaqkpqvlktqpl

SCOPe Domain Coordinates for d3dllg1:

Click to download the PDB-style file with coordinates for d3dllg1.
(The format of our PDB-style files is described here.)

Timeline for d3dllg1: