SCOPe 2.08: Domain d3dlle2: 3dll E:5-82

Lineage for d3dlle2 (3dll E:5-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
   Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172

8. Domain d3dlle2: 3dll E:5-82 [157783]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR E:5-82
   complexed with mg, zld, zn

Details for d3dlle2

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3dlle2:

Sequence; same for both SEQRES and ATOM records:

>d3dlle2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdg

Timeline for d3dlle2:

• d3dlle2 first appeared in SCOP 1.75
  
• d3dlle2 appears in SCOPe 2.07