SCOP 1.75: Domain d3cwtb1: 3cwt B:100-281

Lineage for d3cwtb1 (3cwt B:100-281)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)

7. Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
   Uniprot P04395

8. Domain d3cwtb1: 3cwt B:100-281 [157062]
   Other proteins in same PDB: d3cwta2, d3cwtb2, d3cwtc2, d3cwtd2
   automatically matched to d1diza1
   complexed with 2fi

Details for d3cwtb1

PDB Entry: 3cwt, 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 2'-fluoro-2'- deoxyinosine:adenine base pair

PDB Compounds: (B:) DNA-3-methyladenine glycosylase 2

SCOP Domain Sequences for d3cwtb1:

Sequence; same for both SEQRES and ATOM records:

>d3cwtb1 a.96.1.3 (B:100-281) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
de

Timeline for d3cwtb1:

• d3cwtb1 is new in SCOP 1.75
  
• d3cwtb1 appears in SCOPe 2.01
  
• d3cwtb1 appears in the current release, SCOPe 2.08