SCOP 1.75: Domain d3cwta2: 3cwt A:1-99

Lineage for d3cwta2 (3cwt A:1-99)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
   contains a single copy of this fold

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [55953] (1 species)

7. Species Escherichia coli [TaxId:562] [55954] (11 PDB entries)
   Uniprot P04395

8. Domain d3cwta2: 3cwt A:1-99 [157061]
   Other proteins in same PDB: d3cwta1, d3cwtb1, d3cwtc1, d3cwtd1
   automatically matched to d1diza2
   complexed with 2fi

Details for d3cwta2

PDB Entry: 3cwt, 2.3 Å

PDB Description: crystal structure of an alka host/guest complex 2'-fluoro-2'- deoxyinosine:adenine base pair

PDB Compounds: (A:) DNA-3-methyladenine glycosylase 2

SCOP Domain Sequences for d3cwta2:

Sequence; same for both SEQRES and ATOM records:

>d3cwta2 d.129.1.2 (A:1-99) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlg

Timeline for d3cwta2:

• d3cwta2 is new in SCOP 1.75
  
• d3cwta2 appears in SCOPe 2.01
  
• d3cwta2 appears in the current release, SCOPe 2.08