PDB entry 3cwt

View 3cwt on RCSB PDB site
Description: Crystal Structure of an AlkA Host/Guest Complex 2'-fluoro-2'-deoxyinosine:Adenine Base Pair
Class: hydrolase/DNA
Keywords: AlkA, 2'-fluoro-2'-deoxyinosine, DNA repair, host/guest complex, DNA structure, DNA damage, Hydrolase, hydrolase/DNA COMPLEX
Deposited on 2008-04-22, released 2008-09-02
The last revision prior to the SCOP 1.75 freeze date was dated 2008-11-18, with a file datestamp of 2008-11-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.239
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: ESCHERICHIA COLI
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cwta1, d3cwta2
  • Chain 'B':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: ESCHERICHIA COLI
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cwtb1, d3cwtb2
  • Chain 'C':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: ESCHERICHIA COLI
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cwtc1, d3cwtc2
  • Chain 'D':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: ESCHERICHIA COLI
    Gene: alkA, aidA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cwtd1, d3cwtd2
  • Chain 'E':
    Compound: DNA (5'-d(*dgp*dap*dcp*dap*dtp*dgp*dap*(2fi)p*dtp*dgp*dcp*dc)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*dgp*dgp*dcp*dap*dap*dtp*dcp*dap*dtp*dgp*dtp*dc)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*dgp*dap*dcp*dap*dtp*dgp*dap*(2fi)p*dtp*dgp*dcp*dc)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*dgp*dgp*dcp*dap*dap*dtp*dcp*dap*dtp*dgp*dtp*dc)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cwtA (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cwtB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cwtB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpde
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cwtC (C:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cwtD (D:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cwtD (D:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpde
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.