![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (6 families) ![]() |
![]() | Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) |
![]() | Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48159] (11 PDB entries) Uniprot P04395 |
![]() | Domain d3cwta1: 3cwt A:100-282 [157060] Other proteins in same PDB: d3cwta2, d3cwtb2, d3cwtc2, d3cwtd2 automatically matched to d1diza1 complexed with 2fi |
PDB Entry: 3cwt (more details), 2.3 Å
SCOP Domain Sequences for d3cwta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cwta1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp dea
Timeline for d3cwta1: