Lineage for d1diza1 (1diz A:100-282)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.96.1: DNA-glycosylase [48150] (6 families) 
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
Uniprot P04395
Domain d1diza1: 1diz A:100-282 [18749]
Other proteins in same PDB: d1diza2, d1dizb2
Details for d1diza1
PDB Entry: 1diz (more details), 2.5 Å
PDB Description: crystal structure of e. coli 3-methyladenine dna glycosylase (alka) complexed with dna
PDB Compounds: (A:) 3-methyladenine DNA glycosylase IISCOP Domain Sequences for d1diza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diza1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea
SCOP Domain Coordinates for d1diza1:
Click to download the PDB-style file with coordinates for d1diza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1diza1:
- d1diza1 first appeared (with stable ids) in SCOP 1.55
- d1diza1 appears in SCOP 1.73
- d1diza1 appears in SCOPe 2.01
- d1diza1 appears in the current release, SCOPe 2.08
View in 3D
