Lineage for d3cqzj_ (3cqz J:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985075Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1985076Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1985113Protein automated matches [190336] (3 species)
    not a true protein
  7. 1985114Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187159] (5 PDB entries)
  8. 1985115Domain d3cqzj_: 3cqz J: [156933]
    Other proteins in same PDB: d3cqza1, d3cqzb_, d3cqzf1, d3cqzh_, d3cqzk_, d3cqzl1
    automated match to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3cqzj_

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOPe Domain Sequences for d3cqzj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqzj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d3cqzj_:

Click to download the PDB-style file with coordinates for d3cqzj_.
(The format of our PDB-style files is described here.)

Timeline for d3cqzj_: