Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein automated matches [190336] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187159] (5 PDB entries) |
Domain d3cqzj_: 3cqz J: [156933] Other proteins in same PDB: d3cqza1, d3cqzb_, d3cqzf1, d3cqzh_, d3cqzk_, d3cqzl1 automated match to d1i3qj_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3cqz (more details), 2.8 Å
SCOPe Domain Sequences for d3cqzj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cqzj_ a.4.11.1 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d3cqzj_: