Lineage for d3cqza1 (3cqz A:6-1450)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2270442Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2270443Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2270444Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2270445Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2270446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2270447Domain d3cqza1: 3cqz A:6-1450 [156929]
    Other proteins in same PDB: d3cqzb_, d3cqzf1, d3cqzh_, d3cqzj_, d3cqzk_, d3cqzl1
    automatically matched to d1wcma_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3cqza1

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (A:) DNA-directed RNA polymerase II subunit RPB1

SCOPe Domain Sequences for d3cqza1:

Sequence, based on SEQRES records: (download)

>d3cqza1 i.8.1.1 (A:6-1450) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsidrnl
kcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelmrqa
laikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklvgsw
kkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvpppp
vrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymd
ndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvg
vpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiq
lqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgd
emnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldq
vlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngm
liidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstg
igdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflnea
rdkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlp
hfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkal
edimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntd
htldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiq
naqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsr
latrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfh
fagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlks
vtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraamndk
dltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkkien
tmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidpt
riytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggltsvt
rhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafdvmi
deesl

Sequence, based on observed residues (ATOM records): (download)

>d3cqza1 i.8.1.1 (A:6-1450) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yssaplrtvkevqfglfspeevraisvakirfpetakigglndprlgsidrnlkcqtcqe
gmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelmrqalaikdsk
krfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklvgswkkepelr
vlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrptfkladilkani
sletlehngaphhaieeaesllqfhvatymdfsartvisgdpnleldqvgvpksiaktlt
ypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverh
imdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqse
etraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpd
wdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifg
vvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgpt
mreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaev
nlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspe
skgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnt
trnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpslles
gseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidh
tkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqey
rltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfhfagvaskkvt
sgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyyd
pdprstvipedeeiiqlhfslldqqspwllrleldraamndkdltmgqvgerikqtfknd
lfviwsedndekliircrvveaeedhmlkkientmlenitlrgveniervvmmkydrkvp
sptgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykev
ynviasdgsyvnyrhmallvdvmttqggltsvtrhgmrcsfeetveilfeagasaelddc
rgvsenvilgqmapigtgafdvmideesl

SCOPe Domain Coordinates for d3cqza1:

Click to download the PDB-style file with coordinates for d3cqza1.
(The format of our PDB-style files is described here.)

Timeline for d3cqza1: