Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d3cqzj1: 3cqz J:1-65 [156933] Other proteins in same PDB: d3cqza1, d3cqzb1, d3cqzf1, d3cqzh1, d3cqzk1, d3cqzl1 automatically matched to d1i3qj_ complexed with ilx, trx, zn |
PDB Entry: 3cqz (more details), 2.8 Å
SCOP Domain Sequences for d3cqzj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cqzj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d3cqzj1: