Lineage for d3cqzj1 (3cqz J:1-65)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763391Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 763392Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 763393Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 763396Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 763400Domain d3cqzj1: 3cqz J:1-65 [156933]
    Other proteins in same PDB: d3cqza1, d3cqzb1, d3cqzf1, d3cqzh1, d3cqzk1, d3cqzl1
    automatically matched to d1i3qj_
    complexed with ilx, trx, zn

Details for d3cqzj1

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOP Domain Sequences for d3cqzj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqzj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d3cqzj1:

Click to download the PDB-style file with coordinates for d3cqzj1.
(The format of our PDB-style files is described here.)

Timeline for d3cqzj1: