SCOPe 2.08: Domain d3cpw11: 3cpw 1:1-49

Lineage for d3cpw11 (3cpw 1:1-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d3cpw11: 3cpw 1:1-49 [156904]
   Other proteins in same PDB: d3cpw21, d3cpwb1, d3cpwd1, d3cpwf1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwo1, d3cpwp1, d3cpwq1, d3cpwr1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwx1, d3cpwy1, d3cpwz1
   automatically matched to 1VQ4 2:1-49
   protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpw11

PDB Entry: 3cpw, 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (1:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3cpw11:

Sequence, based on SEQRES records:

>d3cpw11 a.137.1.1 (1:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d3cpw11 a.137.1.1 (1:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d3cpw11:

• d3cpw11 first appeared in SCOP 1.75
  
• d3cpw11 appears in SCOPe 2.07