Lineage for d3cpwo1 (3cpw O:1-143)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720880Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2720881Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2720882Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2720883Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2720884Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2720920Domain d3cpwo1: 3cpw O:1-143 [156915]
    Other proteins in same PDB: d3cpw11, d3cpw21, d3cpwb1, d3cpwd1, d3cpwf1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwp1, d3cpwq1, d3cpwr1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwx1, d3cpwy1, d3cpwz1
    automatically matched to d1s72p_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwo1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3cpwo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpwo1 a.94.1.1 (O:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3cpwo1:

Click to download the PDB-style file with coordinates for d3cpwo1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwo1: