Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cpws1: 3cpw S:1-119 [156919] Other proteins in same PDB: d3cpw11, d3cpwb1, d3cpwf1, d3cpwh1, d3cpwo1, d3cpwq1, d3cpwr1, d3cpwx1, d3cpwy1 automatically matched to d1w2bs_ protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld |
PDB Entry: 3cpw (more details), 2.7 Å
SCOPe Domain Sequences for d3cpws1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cpws1 i.1.1.2 (S:1-119) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d3cpws1: