Lineage for d3cpw21 (3cpw 2:1-92)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2593959Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2594094Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2594241Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2594313Domain d3cpw21: 3cpw 2:1-92 [156905]
    Other proteins in same PDB: d3cpw11, d3cpwb1, d3cpwf1, d3cpwh1, d3cpwo1, d3cpwq1, d3cpwr1, d3cpwx1, d3cpwy1
    automatically matched to d1w2b2_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpw21

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d3cpw21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpw21 i.1.1.2 (2:1-92) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d3cpw21:

Click to download the PDB-style file with coordinates for d3cpw21.
(The format of our PDB-style files is described here.)

Timeline for d3cpw21: