Lineage for d3cmez1 (3cme Z:35-106)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3036998Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 3036999Protein Ribosomal protein L37ae [57831] (1 species)
  7. 3037000Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 3037053Domain d3cmez1: 3cme Z:35-106 [156832]
    Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1
    automatically matched to d1s72z_
    protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmez1

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3cmez1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmez1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3cmez1:

Click to download the PDB-style file with coordinates for d3cmez1.
(The format of our PDB-style files is described here.)

Timeline for d3cmez1: