SCOPe 2.08: Domain d3cmeg1: 3cme G:12-73

Lineage for d3cmeg1 (3cme G:12-73)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d3cmeg1: 3cme G:12-73 [156814]
   Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1
   automatically matched to 1VQ4 G:12-73
   protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmeg1

PDB Entry: 3cme, 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (G:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d3cmeg1:

Sequence, based on SEQRES records:

>d3cmeg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d3cmeg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d3cmeg1:

• d3cmeg1 first appeared in SCOP 1.75
  
• d3cmeg1 appears in SCOPe 2.07