Lineage for d3cmeg1 (3cme G:12-73)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047153Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 3047154Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 3047155Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 3047156Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 3047157Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 3047196Domain d3cmeg1: 3cme G:12-73 [156814]
    Other proteins in same PDB: d3cme11, d3cme21, d3cme31, d3cmeb1, d3cmed1, d3cmef1, d3cmeh1, d3cmei1, d3cmej1, d3cmek1, d3cmel1, d3cmen1, d3cmeo1, d3cmep1, d3cmeq1, d3cmer1, d3cmes1, d3cmet1, d3cmeu1, d3cmev1, d3cmew1, d3cmex1, d3cmey1, d3cmez1
    automatically matched to 1VQ4 G:12-73
    protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmeg1

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d3cmeg1:

Sequence, based on SEQRES records: (download)

>d3cmeg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d3cmeg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d3cmeg1:

Click to download the PDB-style file with coordinates for d3cmeg1.
(The format of our PDB-style files is described here.)

Timeline for d3cmeg1: