Lineage for d3cmek1 (3cme K:1-132)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3044070Domain d3cmek1: 3cme K:1-132 [156818]
    Other proteins in same PDB: d3cme21, d3cmeb1, d3cmef1, d3cmeg1, d3cmeh1, d3cmei1, d3cmep1, d3cmer1, d3cmes1, d3cmey1, d3cmez1
    automatically matched to d1w2bj_
    protein/RNA complex; complexed with aca, cd, cl, k, mg, na, phe, sr

Details for d3cmek1

PDB Entry: 3cme (more details), 2.95 Å

PDB Description: the structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d3cmek1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmek1 i.1.1.2 (K:1-132) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d3cmek1:

Click to download the PDB-style file with coordinates for d3cmek1.
(The format of our PDB-style files is described here.)

Timeline for d3cmek1: