SCOPe 2.08: Domain d3cjqe1: 3cjq E:71-137

Lineage for d3cjqe1 (3cjq E:71-137)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
   Uniprot P36238 70-139! Uniprot P36238 71-137

8. Domain d3cjqe1: 3cjq E:71-137 [156706]
   Other proteins in same PDB: d3cjqa1, d3cjqb2, d3cjqd1, d3cjqe2, d3cjqg1, d3cjqh2
   automatically matched to 3CJR B:71-137
   protein/RNA complex; complexed with 2mm, iod, sah

Details for d3cjqe1

PDB Entry: 3cjq, 2.7 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121

PDB Compounds: (E:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjqe1:

Sequence, based on SEQRES records:

>d3cjqe1 a.4.7.1 (E:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiags
arsmgve

Sequence, based on observed residues (ATOM records):

>d3cjqe1 a.4.7.1 (E:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasyliritweqvleiakqkmpleaaarmiagsarsmgve

Timeline for d3cjqe1:

• d3cjqe1 first appeared in SCOP 1.75
  
• d3cjqe1 appears in SCOPe 2.07