Lineage for d3cjqb1 (3cjq B:71-137)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695516Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 2695522Domain d3cjqb1: 3cjq B:71-137 [156703]
    Other proteins in same PDB: d3cjqa1, d3cjqb2, d3cjqd1, d3cjqe2, d3cjqg1, d3cjqh2
    automatically matched to 3CJR B:71-137
    protein/RNA complex; complexed with 2mm, iod, sah

Details for d3cjqb1

PDB Entry: 3cjq (more details), 2.7 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121
PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjqb1:

Sequence, based on SEQRES records: (download)

>d3cjqb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiags
arsmgve

Sequence, based on observed residues (ATOM records): (download)

>d3cjqb1 a.4.7.1 (B:71-137) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
tppasyliritweqvleiakqkmpdlnttdleaaarmiagsarsmgve

SCOPe Domain Coordinates for d3cjqb1:

Click to download the PDB-style file with coordinates for d3cjqb1.
(The format of our PDB-style files is described here.)

Timeline for d3cjqb1: