PDB entry 3cjq

View 3cjq on RCSB PDB site
Description: Ribosomal protein L11 methyltransferase (PrmA) in complex with dimethylated ribosomal protein L11 in space group P212121
Class: Transferase/Ribosomal protein
Keywords: S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, Transferase-Ribosomal protein COMPLEX
Deposited on 2008-03-13, released 2008-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cjqa1
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36238 (0-End)
      • engineered (37)
    Domains in SCOPe 2.07: d3cjqb1, d3cjqb2
  • Chain 'D':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cjqd1
  • Chain 'E':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36238 (0-End)
      • engineered (37)
    Domains in SCOPe 2.07: d3cjqe1, d3cjqe2
  • Chain 'G':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus
    Gene: prmA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cjqg1
  • Chain 'H':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36238 (0-End)
      • engineered (37)
    Domains in SCOPe 2.07: d3cjqh1, d3cjqh2
  • Heterogens: IOD, SAH, 2MM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cjqA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjqA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgddwle
    awrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrpg
    dkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalp
    fgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrplee
    aaegewvllaygr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cjqB (B:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya
    drsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdle
    aaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjqB (B:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya
    drsftfvtktppasyliritweqvleiakqkmpdlnttdleaaarmiagsarsmgvevvg
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cjqD (D:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjqD (D:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevedwlea
    wrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrpgd
    kvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpf
    gpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleea
    aegewvllaygr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cjqE (E:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya
    drsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdle
    aaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjqE (E:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya
    drsftfvtktppasyliritweqvleiakqkmpleaaarmiagsarsmgvevvga
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3cjqG (G:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjqG (G:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdwlea
    wrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrpgd
    kvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpf
    gpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleea
    aegewvllaygr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cjqH (H:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya
    drsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdle
    aaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjqH (H:)
    kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya
    drsftfvtktppasyliritweqvleiakqkmpdlnttdleaaarmiagsarsmgvevvg
    a