SCOPe 2.08: Domain d1eyxa_: 1eyx A:

Lineage for d1eyxa_ (1eyx A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycoerythrin alpha subunit [88961] (3 species)

7. Species Red algae (Gracilaria chilensis) [TaxId:2775] [88512] (1 PDB entry)

8. Domain d1eyxa_: 1eyx A: [15669]
   Other proteins in same PDB: d1eyxb_, d1eyxl_
   complexed with bla, cyc, pub, so4

Details for d1eyxa_

PDB Entry: 1eyx, 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms

PDB Compounds: (A:) r-phycoerythrin

SCOPe Domain Sequences for d1eyxa_:

Sequence; same for both SEQRES and ATOM records:

>d1eyxa_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mksvittvisaadsagrfpsssdlesvqgniqrasarleaaeklasnheavvkeagdacf
gkygylknpgeagenqekinkcyrdidhymrlvnyslviggtgpldewgiagarevyrtl
nlptsayiaafaftrdrlcgprdmsaqagveystaldyiinsls

Timeline for d1eyxa_:

• d1eyxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyxa_ appears in SCOPe 2.07