SCOP 1.55: Domain d1eyxa_: 1eyx A:

Lineage for d1eyxa_ (1eyx A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.3: Phycocyanins [46532] (5 proteins)

6. Protein Phycoerythrin [46540] (5 species)

7. Species Red algae (Gracilaria chilensis) [TaxId:2775] [46543] (1 PDB entry)
8. Domain d1eyxa_: 1eyx A: [15669]

Details for d1eyxa_

PDB Entry: 1eyx, 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms

SCOP Domain Sequences for d1eyxa_:

Sequence; same for both SEQRES and ATOM records:

>d1eyxa_ a.1.1.3 (A:) Phycoerythrin {Red algae (Gracilaria chilensis)}
mksvittvisaadsagrfpsssdlesvqgniqrasarleaaeklasnheavvkeagdacf
gkygylknpgeagenqekinkcyrdidhymrlvnyslviggtgpldewgiagarevyrtl
nlptsayiaafaftrdrlcgprdmsaqagveystaldyiinsls

SCOP Domain Coordinates for d1eyxa_ are not available.

Timeline for d1eyxa_:

• d1eyxa_ appears in SCOP 1.57
  
• d1eyxa_ appears in the current release, SCOPe 2.08