SCOPe 2.08: Domain d1eyxb_: 1eyx B:

Lineage for d1eyxb_ (1eyx B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Red algae (Gracilaria chilensis) [TaxId:2775] [88516] (1 PDB entry)

8. Domain d1eyxb_: 1eyx B: [15670]
   Other proteins in same PDB: d1eyxa_, d1eyxk_
   complexed with bla, cyc, pub, so4

Details for d1eyxb_

PDB Entry: 1eyx, 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms

PDB Compounds: (B:) r-phycoerythrin

SCOPe Domain Sequences for d1eyxb_:

Sequence; same for both SEQRES and ATOM records:

>d1eyxb_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi
cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial
gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs

Timeline for d1eyxb_:

• d1eyxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyxb_ appears in SCOPe 2.07