| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (1 protein) |
| Protein 50S subunit [58125] (6 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d3ccu11: 3ccu 1:1-56 [156428] Other proteins in same PDB: d3ccu21, d3ccub1, d3ccuf1, d3ccuh1, d3ccui1, d3ccup1, d3ccur1, d3ccus1, d3ccuy1, d3ccuz1 automatically matched to d1w2bz_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOP Domain Sequences for d3ccu11:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccu11 i.1.1.2 (1:1-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d3ccu11: