Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries) Uniprot P14122 67-136 |
Domain d3ccui1: 3ccu I:66-129 [156435] Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1 automatically matched to d1s72i_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3ccu (more details), 2.8 Å
SCOP Domain Sequences for d3ccui1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccui1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]} gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg tcts
Timeline for d3ccui1: