Lineage for d3ccup1 (3ccu P:1-143)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773657Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 773658Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 773659Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 773660Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 773661Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 773677Domain d3ccup1: 3ccu P:1-143 [156441]
    Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1
    automatically matched to d1s72p_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccup1

PDB Entry: 3ccu (more details), 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d3ccup1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccup1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d3ccup1:

Click to download the PDB-style file with coordinates for d3ccup1.
(The format of our PDB-style files is described here.)

Timeline for d3ccup1: