Lineage for d3ccuy1 (3ccu Y:95-236)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823885Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 823930Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 823931Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 823932Protein Ribosomal protein L32e [52044] (1 species)
  7. 823933Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 823949Domain d3ccuy1: 3ccu Y:95-236 [156450]
    Other proteins in same PDB: d3ccu11, d3ccu21, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuz1
    automatically matched to d1jj2x_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccuy1

PDB Entry: 3ccu (more details), 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOP Domain Sequences for d3ccuy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccuy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d3ccuy1:

Click to download the PDB-style file with coordinates for d3ccuy1.
(The format of our PDB-style files is described here.)

Timeline for d3ccuy1: