Lineage for d3ccu21 (3ccu 2:1-49)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778338Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 778339Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 778340Protein Ribosomal protein L39e [48664] (1 species)
  7. 778341Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 778357Domain d3ccu21: 3ccu 2:1-49 [156429]
    Other proteins in same PDB: d3ccu11, d3ccu31, d3ccub1, d3ccud1, d3ccuf1, d3ccuh1, d3ccui1, d3ccuj1, d3ccuk1, d3ccul1, d3ccun1, d3ccuo1, d3ccup1, d3ccuq1, d3ccur1, d3ccus1, d3ccut1, d3ccuu1, d3ccuv1, d3ccuw1, d3ccux1, d3ccuy1, d3ccuz1
    automatically matched to 1VQ4 2:1-49
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccu21

PDB Entry: 3ccu (more details), 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOP Domain Sequences for d3ccu21:

Sequence, based on SEQRES records: (download)

>d3ccu21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3ccu21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOP Domain Coordinates for d3ccu21:

Click to download the PDB-style file with coordinates for d3ccu21.
(The format of our PDB-style files is described here.)

Timeline for d3ccu21: