Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) automatically mapped to Pfam PF01780 |
Protein Ribosomal protein L37ae [57831] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries) Uniprot P60619 |
Domain d3ccrz1: 3ccr Z:35-106 [156403] Other proteins in same PDB: d3ccr11, d3ccr21, d3ccr31, d3ccrb1, d3ccrd1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrj1, d3ccrk1, d3ccrl1, d3ccrn1, d3ccro1, d3ccrp1, d3ccrq1, d3ccrr1, d3ccrs1, d3ccrt1, d3ccru1, d3ccrv1, d3ccrw1, d3ccrx1, d3ccry1 automatically matched to d1s72z_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccr (more details), 3 Å
SCOPe Domain Sequences for d3ccrz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccrz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]} sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk petpggktvrrs
Timeline for d3ccrz1: