![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Prokaryotic (50S subunit) [58125] (3 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccrw1: 3ccr W:1-154 [156400] Other proteins in same PDB: d3ccr21, d3ccrb1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrp1, d3ccrr1, d3ccrs1, d3ccry1, d3ccrz1 automatically matched to d1w2bv_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccr (more details), 3 Å
SCOPe Domain Sequences for d3ccrw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccrw1 i.1.1.2 (W:1-154) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d3ccrw1: