Lineage for d3ccrf1 (3ccr F:1-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960098Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2960115Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2960123Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2960177Domain d3ccrf1: 3ccr F:1-119 [156385]
    Other proteins in same PDB: d3ccr11, d3ccr21, d3ccr31, d3ccrb1, d3ccrd1, d3ccrh1, d3ccri1, d3ccrj1, d3ccrk1, d3ccrl1, d3ccrn1, d3ccro1, d3ccrp1, d3ccrq1, d3ccrr1, d3ccrs1, d3ccrt1, d3ccru1, d3ccrv1, d3ccrw1, d3ccrx1, d3ccry1, d3ccrz1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccrf1

PDB Entry: 3ccr (more details), 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3ccrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccrf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3ccrf1:

Click to download the PDB-style file with coordinates for d3ccrf1.
(The format of our PDB-style files is described here.)

Timeline for d3ccrf1: