Lineage for d3ccez1 (3cce Z:35-106)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3036998Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 3036999Protein Ribosomal protein L37ae [57831] (1 species)
  7. 3037000Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 3037037Domain d3ccez1: 3cce Z:35-106 [156283]
    Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1
    automatically matched to d1s72z_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccez1

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3ccez1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccez1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3ccez1:

Click to download the PDB-style file with coordinates for d3ccez1.
(The format of our PDB-style files is described here.)

Timeline for d3ccez1: