Lineage for d3cceb1 (3cce B:1-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793163Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2793164Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2793205Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 2793242Domain d3cceb1: 3cce B:1-337 [156263]
    Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1, d3ccez1
    automatically matched to d1jj2b_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cceb1

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d3cceb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cceb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d3cceb1:

Click to download the PDB-style file with coordinates for d3cceb1.
(The format of our PDB-style files is described here.)

Timeline for d3cceb1: