![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix automatically mapped to Pfam PF00832 |
![]() | Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
![]() | Protein Ribosomal protein L39e [48664] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
![]() | Domain d3cce21: 3cce 2:1-49 [156261] Other proteins in same PDB: d3cce11, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1, d3ccez1 automatically matched to 1VQ4 2:1-49 complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cce (more details), 2.75 Å
SCOPe Domain Sequences for d3cce21:
Sequence, based on SEQRES records: (download)
>d3cce21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d3cce21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d3cce21: