Lineage for d3c8dd1 (3c8d D:6-150)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112329Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
    PfamB PB013071
  6. 1112330Protein Enterochelin esterase [141031] (1 species)
  7. 1112331Species Shigella flexneri 2a str. 2457T [TaxId:198215] [141032] (4 PDB entries)
    Uniprot Q83SB9 3-150
  8. 1112335Domain d3c8dd1: 3c8d D:6-150 [156031]
    Other proteins in same PDB: d3c8da2, d3c8db2, d3c8dc2, d3c8dd2
    automatically matched to d2b20a1
    complexed with cit

Details for d3c8dd1

PDB Entry: 3c8d (more details), 1.8 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-glycine
PDB Compounds: (D:) enterochelin esterase

SCOPe Domain Sequences for d3c8dd1:

Sequence, based on SEQRES records: (download)

>d3c8dd1 b.1.18.20 (D:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqp
qsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaia
dplnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records): (download)

>d3c8dd1 b.1.18.20 (D:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdsqpqsmq
riagtdvwqwttqlnanwrgsycfipterddifsapdrlelregwrkllpqaiadplnpq
swkglghavsalempqap

SCOPe Domain Coordinates for d3c8dd1:

Click to download the PDB-style file with coordinates for d3c8dd1.
(The format of our PDB-style files is described here.)

Timeline for d3c8dd1: