![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein) PfamB PB013071 |
![]() | Protein Enterochelin esterase [141031] (2 species) |
![]() | Species Shigella flexneri 2a str. 2457T [TaxId:198215] [158885] (3 PDB entries) |
![]() | Domain d3c8dd1: 3c8d D:6-150 [156031] Other proteins in same PDB: d3c8da2, d3c8db2, d3c8dc2, d3c8dd2 automatically matched to d2b20a1 complexed with cit |
PDB Entry: 3c8d (more details), 1.8 Å
SCOPe Domain Sequences for d3c8dd1:
Sequence, based on SEQRES records: (download)
>d3c8dd1 b.1.18.20 (D:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqp qsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaia dplnpqswkgglghavsalempqap
>d3c8dd1 b.1.18.20 (D:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdsqpqsmq riagtdvwqwttqlnanwrgsycfipterddifsapdrlelregwrkllpqaiadplnpq swkglghavsalempqap
Timeline for d3c8dd1: