SCOPe 2.08: Domain d3c8dd1: 3c8d D:6-150

Lineage for d3c8dd1 (3c8d D:6-150)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
   PfamB PB013071
   automatically mapped to Pfam PF11806

6. Protein Enterochelin esterase [141031] (1 species)

7. Species Shigella flexneri 2a str. 2457T [TaxId:198215] [141032] (4 PDB entries)
   Uniprot Q83SB9 3-150

8. Domain d3c8dd1: 3c8d D:6-150 [156031]
   Other proteins in same PDB: d3c8da2, d3c8db2, d3c8dc2, d3c8dd2
   automated match to d2b20a1
   complexed with cit

Details for d3c8dd1

PDB Entry: 3c8d, 1.8 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-glycine

PDB Compounds: (D:) enterochelin esterase

SCOPe Domain Sequences for d3c8dd1:

Sequence, based on SEQRES records:

>d3c8dd1 b.1.18.20 (D:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqp
qsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaia
dplnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records):

>d3c8dd1 b.1.18.20 (D:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
vgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdsqpqsmq
riagtdvwqwttqlnanwrgsycfipterddifsapdrlelregwrkllpqaiadplnpq
swkglghavsalempqap

Timeline for d3c8dd1:

• d3c8dd1 first appeared in SCOP 1.75
  
• d3c8dd1 appears in SCOPe 2.07