Lineage for d3c8db1 (3c8d B:7-150)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938222Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
    PfamB PB013071
  6. 938223Protein Enterochelin esterase [141031] (2 species)
  7. 938224Species Shigella flexneri 2a str. 2457T [TaxId:198215] [158885] (3 PDB entries)
  8. 938226Domain d3c8db1: 3c8d B:7-150 [156027]
    Other proteins in same PDB: d3c8da2, d3c8db2, d3c8dc2, d3c8dd2
    automatically matched to d2b20a1
    complexed with cit

Details for d3c8db1

PDB Entry: 3c8d (more details), 1.8 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-glycine
PDB Compounds: (B:) enterochelin esterase

SCOPe Domain Sequences for d3c8db1:

Sequence, based on SEQRES records: (download)

>d3c8db1 b.1.18.20 (B:7-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
gseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqpq
smqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiad
plnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records): (download)

>d3c8db1 b.1.18.20 (B:7-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
gseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdpqsmqria
gtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpqs
wklghavsalempqap

SCOPe Domain Coordinates for d3c8db1:

Click to download the PDB-style file with coordinates for d3c8db1.
(The format of our PDB-style files is described here.)

Timeline for d3c8db1: