Lineage for d3c8dc2 (3c8d C:151-396)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1179308Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1179323Protein Enterochelin esterase, catalytic domain [142699] (2 species)
  7. 1179324Species Shigella flexneri 2a str. 2457T [TaxId:198215] [159733] (3 PDB entries)
  8. 1179327Domain d3c8dc2: 3c8d C:151-396 [156030]
    Other proteins in same PDB: d3c8da1, d3c8db1, d3c8dc1, d3c8dd1
    automatically matched to d2b20a2
    complexed with cit

Details for d3c8dc2

PDB Entry: 3c8d (more details), 1.8 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of 2,3-Di-hydroxy-N-benzoyl-glycine
PDB Compounds: (C:) enterochelin esterase

SCOPe Domain Sequences for d3c8dc2:

Sequence, based on SEQRES records: (download)

>d3c8dc2 c.69.1.2 (C:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplf

Sequence, based on observed residues (ATOM records): (download)

>d3c8dc2 c.69.1.2 (C:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgerplavlldgefwaqsmpvwpvl
tslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdradrt
vvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsaegl
rivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwqpl
f

SCOPe Domain Coordinates for d3c8dc2:

Click to download the PDB-style file with coordinates for d3c8dc2.
(The format of our PDB-style files is described here.)

Timeline for d3c8dc2: