SCOPe 2.08: Domain d3c5gb2: 3c5g B:329-385

Lineage for d3c5gb2 (3c5g B:329-385)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)

8. Domain d3c5gb2: 3c5g B:329-385 [155947]
   Other proteins in same PDB: d3c5ga1, d3c5ga3, d3c5gb1, d3c5gb3
   automated match to d1xsna2
   protein/DNA complex; complexed with d3t, edo, mg, na; mutant

Details for d3c5gb2

PDB Entry: 3c5g, 2.2 Å

PDB Description: structure of a ternary complex of the r517k pol lambda mutant

PDB Compounds: (B:) DNA polymerase lambda

SCOPe Domain Sequences for d3c5gb2:

Sequence; same for both SEQRES and ATOM records:

>d3c5gb2 a.60.12.1 (B:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d3c5gb2:

• d3c5gb2 first appeared in SCOP 1.75
  
• d3c5gb2 appears in SCOPe 2.07