Lineage for d3c5gb2 (3c5g B:329-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716399Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2716577Protein DNA polymerase lambda [101253] (1 species)
  7. 2716578Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2716611Domain d3c5gb2: 3c5g B:329-385 [155947]
    Other proteins in same PDB: d3c5ga1, d3c5ga3, d3c5gb1, d3c5gb3
    automated match to d1xsna2
    protein/DNA complex; complexed with d3t, edo, mg, na; mutant

Details for d3c5gb2

PDB Entry: 3c5g (more details), 2.2 Å

PDB Description: structure of a ternary complex of the r517k pol lambda mutant
PDB Compounds: (B:) DNA polymerase lambda

SCOPe Domain Sequences for d3c5gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5gb2 a.60.12.1 (B:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d3c5gb2:

Click to download the PDB-style file with coordinates for d3c5gb2.
(The format of our PDB-style files is described here.)

Timeline for d3c5gb2: