Lineage for d3bx1b_ (3bx1 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481297Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2481298Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2481299Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2481611Protein automated matches [190073] (16 species)
    not a true protein
  7. 2481643Species Bacillus lentus [TaxId:1467] [187257] (4 PDB entries)
  8. 2481648Domain d3bx1b_: 3bx1 B: [155703]
    Other proteins in same PDB: d3bx1c_, d3bx1d_
    automated match to d1c9ma_
    complexed with ca, cl, na

Details for d3bx1b_

PDB Entry: 3bx1 (more details), 1.85 Å

PDB Description: Complex between the Barley alpha-Amylase/Subtilisin Inhibitor and the subtilisin Savinase
PDB Compounds: (B:) Subtilisin Savinase

SCOPe Domain Sequences for d3bx1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bx1b_ c.41.1.1 (B:) automated matches {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d3bx1b_:

Click to download the PDB-style file with coordinates for d3bx1b_.
(The format of our PDB-style files is described here.)

Timeline for d3bx1b_: