SCOPe 2.07: Domain d3bx1d_: 3bx1 D:

Lineage for d3bx1d_ (3bx1 D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein Amylase/subtilisin inhibitor [50396] (1 species)

7. Species Barley (Hordeum vulgare), seed [TaxId:4513] [50397] (2 PDB entries)

8. Domain d3bx1d_: 3bx1 D: [155705]
   Other proteins in same PDB: d3bx1a_, d3bx1b_
   automated match to d1avac_
   complexed with ca, cl, na

Details for d3bx1d_

PDB Entry: 3bx1, 1.85 Å

PDB Description: Complex between the Barley alpha-Amylase/Subtilisin Inhibitor and the subtilisin Savinase

PDB Compounds: (D:) Alpha-amylase/subtilisin inhibitor

SCOPe Domain Sequences for d3bx1d_:

Sequence; same for both SEQRES and ATOM records:

>d3bx1d_ b.42.4.1 (D:) Amylase/subtilisin inhibitor {Barley (Hordeum vulgare), seed [TaxId: 4513]}
adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv
ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps
grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp
a

Timeline for d3bx1d_:

• d3bx1d_ first appeared in SCOP 1.75, called d3bx1d1
  
• d3bx1d_ appears in SCOPe 2.06
  
• d3bx1d_ appears in the current release, SCOPe 2.08