Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) automatically mapped to Pfam PF00197 |
Protein Amylase/subtilisin inhibitor [50396] (1 species) |
Species Barley (Hordeum vulgare), seed [TaxId:4513] [50397] (2 PDB entries) |
Domain d3bx1d_: 3bx1 D: [155705] Other proteins in same PDB: d3bx1a_, d3bx1b_ automated match to d1avac_ complexed with ca, cl, na |
PDB Entry: 3bx1 (more details), 1.85 Å
SCOPe Domain Sequences for d3bx1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx1d_ b.42.4.1 (D:) Amylase/subtilisin inhibitor {Barley (Hordeum vulgare), seed [TaxId: 4513]} adpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfpv ritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsps grenafriekysgaevheyklmscgdwcqdlgvfrdlkggawflgatepyhvvvfkkapp a
Timeline for d3bx1d_: