Lineage for d3bx1b1 (3bx1 B:1-275)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 832496Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 832497Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 832498Family c.41.1.1: Subtilases [52744] (13 proteins)
  6. 832575Protein Subtilisin [52745] (6 species)
  7. 832629Species Bacillus lentus [TaxId:1467] [52750] (10 PDB entries)
  8. 832640Domain d3bx1b1: 3bx1 B:1-275 [155703]
    Other proteins in same PDB: d3bx1c1, d3bx1d1
    automatically matched to d1gcia_
    complexed with ca, cl, na

Details for d3bx1b1

PDB Entry: 3bx1 (more details), 1.85 Å

PDB Description: Complex between the Barley alpha-Amylase/Subtilisin Inhibitor and the subtilisin Savinase
PDB Compounds: (B:) Subtilisin Savinase

SCOP Domain Sequences for d3bx1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bx1b1 c.41.1.1 (B:1-275) Subtilisin {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOP Domain Coordinates for d3bx1b1:

Click to download the PDB-style file with coordinates for d3bx1b1.
(The format of our PDB-style files is described here.)

Timeline for d3bx1b1: