SCOPe 2.06: Domain d3bx1b_: 3bx1 B:

Lineage for d3bx1b_ (3bx1 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (15 species)
   not a true protein

7. Species Bacillus lentus [TaxId:1467] [187257] (4 PDB entries)

8. Domain d3bx1b_: 3bx1 B: [155703]
   Other proteins in same PDB: d3bx1c_, d3bx1d_
   automated match to d1c9ma_
   complexed with ca, cl, na

Details for d3bx1b_

PDB Entry: 3bx1, 1.85 Å

PDB Description: Complex between the Barley alpha-Amylase/Subtilisin Inhibitor and the subtilisin Savinase

PDB Compounds: (B:) Subtilisin Savinase

SCOPe Domain Sequences for d3bx1b_:

Sequence; same for both SEQRES and ATOM records:

>d3bx1b_ c.41.1.1 (B:) automated matches {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

Timeline for d3bx1b_:

• d3bx1b_ first appeared in SCOP 1.75, called d3bx1b1
  
• d3bx1b_ appears in SCOPe 2.05
  
• d3bx1b_ appears in SCOPe 2.07
  
• d3bx1b_ appears in the current release, SCOPe 2.08