Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (14 proteins) |
Protein automated matches [190073] (15 species) not a true protein |
Species Bacillus lentus [TaxId:1467] [187257] (4 PDB entries) |
Domain d3bx1b_: 3bx1 B: [155703] Other proteins in same PDB: d3bx1c_, d3bx1d_ automated match to d1c9ma_ complexed with ca, cl, na |
PDB Entry: 3bx1 (more details), 1.85 Å
SCOPe Domain Sequences for d3bx1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx1b_ c.41.1.1 (B:) automated matches {Bacillus lentus [TaxId: 1467]} aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi rnhlkntatslgstnlygsglvnaeaatr
Timeline for d3bx1b_: